DPCstruct | MC2407
Metacluster Properties and Pfam Annotations
| Number of structural domains | 30 |
|---|---|
| Mean domain length (aa) | 92 ± 14 aa |
| Standard deviation of domain lengths | 14.22 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 70.07 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 49.94 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0187 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A834ZAD2 | 3-76 | IPVIFLTILLLFVAADAIRGLKNSRCDEVYVVSDGETLQTISEKCDSLFLLLDNPHILDTDDVVPGTVLLIKST |
| A0A803PQW6 | 98-185 | DRASWYCAVVLLSLILVASVRQSSNSDDSFRGNRFLDRPCDEIYVVGEGETLHTISDKCSDPFIVERNPHIHDPDDVFPGLVIKITPS |
| A0A5E4F1E4 | 2-125 | None |
| A0A843WHL9 | 172-277 | None |
| A0A4U6U768 | 107-225 | None |
| A0A5D3DLK6 | 2-75 | None |
| A0A5P1F4M0 | 5-98 | None |
| Q9FIS3 | 3-99 | None |
| A0A7J6E9H0 | 4-98 | None |
| A0A498I582 | 5-111 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.