DPCstruct | MC24069
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 126 ± 21 aa |
| Standard deviation of domain lengths | 21.41 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 82.62 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 33.87 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF02322 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A848QCE1 | 57-192 | WEGNQVWFILAGGATFAAWPTLYAVSFSGMYFAIALVLLALILRPVGFNFRGKIHDPRWASLWDWVLTGSGLAVMLVAGIAFGNLFL… |
| A0A3M7LI55 | 1-149 | WDGNQVWLITAGGAIFAIWPLVYATAFSSFYLAMMLLLAALWLRPIGMDYRSKIDNPSWRKACDNALFISGVVPPLIFGIGFGNLLV… |
| A0A484YY71 | 24-130 | None |
| A0A378LQ48 | 515-677 | None |
| A0A378BCY6 | 9-153 | None |
| A0A377F7F0 | 2-105 | None |
| A0A1L8ZQL0 | 27-135 | None |
| A0A0L0M9F2 | 26-141 | None |
| A0A379WDK9 | 6-147 | None |
| A0A2X2SR86 | 2-111 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.