DPCstruct | MC24068
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 104 ± 17 aa |
| Standard deviation of domain lengths | 16.55 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 83.86 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 26.53 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A431HQL2 | 183-277 | FPRKELQHSEFVMLNTQMAKELLAAVWTEQDGNRKVKYNVKEAYKRDILNDCWIPSDESIGIDYNHVVYNGRHRLTALIESEKEWPF… |
| A0A3M7LG70 | 84-177 | VVQTTLKHATIFISPQLARNMLTFSSRGSVNKKNKNRRLSKIKVRKYAESMKRREWCLTGEPIIISYEGEILNGHHRLEAACEACVG… |
| A0A7Y0MWW1 | 79-175 | None |
| A0A0F9YBN8 | 2-115 | None |
| I6AWV0 | 8-157 | None |
| A0A2D6W217 | 77-160 | None |
| A0A0F9BU72 | 6-109 | None |
| A0A6I1JY39 | 1-131 | None |
| A0A1H2DWM1 | 24-112 | None |
| A0A1X2YR41 | 299-414 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.