DPCstruct | MC24061
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 124 ± 16 aa |
| Standard deviation of domain lengths | 16.36 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 85.65 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 27.10 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| F8PGV2 | 374-512 | IDAGTPQYKRSKSLQRQVAMIEEDKDTDYFLFNSSGQPIRFTIRDMFAKMNFRILRRMAMSTANKEGLEAMAEYMIKYMRDLPGLSR… |
| A0A369K2X0 | 1-121 | MQDLGFGKPDPSRPYSPALQRQVSLLTGDKSADYFLFDEVDRPIRVEVPSMLTRMTFRILRSDALSKQTPDGVQAIGEYLLKNMSNH… |
| A0A6T8PL04 | 56-144 | None |
| A0A6A4HUH7 | 56-193 | None |
| A0A166B6V1 | 2-125 | None |
| F8PD14 | 213-356 | None |
| A0A1J8PP22 | 350-481 | None |
| A0A0C3QD40 | 8-115 | None |
| A0A284R329 | 348-465 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.