DPCstruct | MC24060
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 110 ± 13 aa |
| Standard deviation of domain lengths | 12.96 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 76.58 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 26.05 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A166B0N9 | 1-101 | MPLFYAYIANIGDEETFRWQAVFASRAVADEWWRALSASPHARFIKRVAPGVYAQDATQRNLSDLFDIPELKPIAEMFRGRVQFADL… |
| A0A067Q9T9 | 1-118 | MSPFYAYVQNVADDNTWRFLLTFASQDVCDEWWRVVSTPPSPWASSMTRINPQFYTHNANLINIWDFFTRGDFVTSSRAFVGRFFLT… |
| E2LSY8 | 1-118 | None |
| A0A3M7LZL9 | 579-704 | None |
| A0A1L9U5L5 | 1-101 | None |
| A0A5N6FNY3 | 1-92 | None |
| A0A167XPN4 | 1-106 | None |
| A0A4Z1PB84 | 149-234 | None |
| A0A166F0Q6 | 1-117 | None |
| A0A6A6FTI0 | 73-197 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.