DPCstruct | MC2406
Metacluster Properties and Pfam Annotations
| Number of structural domains | 49 |
|---|---|
| Mean domain length (aa) | 240 ± 54 aa |
| Standard deviation of domain lengths | 53.52 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 79.00 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 37.78 |
| Pfam Score | 99.12 |
| Assigned Pfam label(s) | PF07851- CL0512 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A803PPH5 | 547-802 | LPAKAHGRFLRMFLGPINVRASRKDIQLKVKEEYNSYRDRTALLFLLFPFILLILRSWKWDGCLPAFPVQLYQAWLLFLYTGLALRE… |
| A0A0R3Q256 | 7-192 | FYFKKDYEKFKLRFTLFNLFPLAIAFIFPSRPMDSICHFLMVWYYCTLTIRESILILNGSKLGSWWVAHHYLACVIGGVALTWPDDA… |
| A0A182J3M5 | 9-286 | None |
| A0A0V0Y436 | 67-338 | None |
| A0A1P8B4R5 | 8-225 | None |
| A0A498NLJ5 | 178-413 | None |
| A0A7J8TZY4 | 306-480 | None |
| H3E6A9 | 69-285 | None |
| A0A0D8XM98 | 51-273 | None |
| A0A7R9PZ54 | 3-176 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.