DPCstruct | MC24059
Metacluster Properties and Pfam Annotations
| Number of structural domains | 34 |
|---|---|
| Mean domain length (aa) | 74 ± 10 aa |
| Standard deviation of domain lengths | 10.02 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 76.47 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 36.91 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A433QY88 | 1-72 | MRTANFIFALSLLFLILSVPNVNGECSRYWSGTAPFCAGSCPEGYTEITRSSCGDGACCWTGYKVLCEKCID |
| A0A067Q9S4 | 7-74 | LLVFVATLFVTGQAATLTTESSAADGCFWDGTAPFCTGHCPRGYVEEGRSSCGDGACCWTGYKTYCCP |
| A0A420NHM3 | 6-70 | None |
| E9GP15 | 1-58 | None |
| E9H0S8 | 6-87 | None |
| E9H0S9 | 223-283 | None |
| A0A6F8ZXG4 | 195-272 | None |
| A0A6A6JF17 | 5-75 | None |
| A0A420NY89 | 5-65 | None |
| A0A815WPW6 | 80-151 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.