DPCstruct | MC24058
Metacluster Properties and Pfam Annotations
| Number of structural domains | 28 |
|---|---|
| Mean domain length (aa) | 113 ± 21 aa |
| Standard deviation of domain lengths | 21.11 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 74.82 |
| Mean fraction of residues predicted as intrinsically disordered | 0.93 |
| Mean length-normalized TM-Score | 0.39 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 35.94 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF10346 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A067Q2K4 | 28-134 | DPTRVAAGLKAAIHNPNVSEEAKERAAERLESMGQETGQTLGSHTIEGLSTHRHATDTSGTRVSAGDDETHNRQMGGYKATLKNPNV… |
| A0A067TE34 | 34-156 | AHGKNPERVAAGLKATLHNPATSPEAKDSARHRLHEMGEKDPERVAAGLKASLHNPATSSEAKKHASSRLVELGYEIDESGKVSAAE… |
| B8PL21 | 423-506 | None |
| A0A0K6FKE8 | 46-130 | None |
| A0A0D6EPE7 | 25-115 | None |
| A0A5C3LJH0 | 30-191 | None |
| B6JX33 | 3-130 | None |
| A0A0H2RSD0 | 1-87 | None |
| A0A1Y1YAT3 | 1-127 | None |
| A0A2A9NUP9 | 1-102 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.