DPCstruct | MC24053
Metacluster Properties and Pfam Annotations
| Number of structural domains | 35 |
|---|---|
| Mean domain length (aa) | 62 ± 4 aa |
| Standard deviation of domain lengths | 4.40 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 86.97 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 51.92 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0P8Y8P1 | 1-65 | MRMLTPREQFRAQGFPDSYIIDRGADGRVMPKTQQTHKCGNSVSPNVAAALVAANCAHLIERKTT |
| A0A4U9D9M9 | 1-59 | MLQPRELYRAQGFPEWYIIDRDYRGVKYAKDKQVARCGNAVPPPFAEALVRANLPEICQ |
| B7X0T3 | 29-87 | None |
| A0A6M3V8P7 | 134-188 | None |
| A4WB48 | 34-95 | None |
| A0A484X790 | 337-395 | None |
| A0A5C8AH07 | 115-178 | None |
| A0A7C9K423 | 228-285 | None |
| A0A438KXC7 | 264-330 | None |
| A0A3M0M8B3 | 405-476 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.