DPCstruct | MC24051
Metacluster Properties and Pfam Annotations
| Number of structural domains | 129 |
|---|---|
| Mean domain length (aa) | 108 ± 22 aa |
| Standard deviation of domain lengths | 22.09 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 88.68 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 26.29 |
| Pfam Score | 89.20 |
| Assigned Pfam label(s) | PF03900- CL0177 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| B7FFZ8 | 112-211 | MLPAVAQGAIGIACRSNDDKMAEYLASLNHEETRLAISCERAFLTTLDGSCRTPIAGYASRDKDGNCLFRGLVASPDGTRVLETSRI… |
| A0A7C3ILI3 | 247-338 | RTDDYRVINIVSVLDDPVTHCAVAAERAFLAALGGGCRRPIGVYGELRDEQLHLYGRIIDEHSNAVIEGKISGRSQECEVIAQNLAR… |
| K3W5I8 | 455-560 | None |
| A0A3D1QYZ5 | 64-177 | None |
| A0A7Y2D1J8 | 564-669 | None |
| A0A7C7V706 | 1-83 | None |
| Q1HRH6 | 7-108 | None |
| A0A848V8K2 | 2-67 | None |
| A0A2N9G934 | 959-1057 | None |
| A0A183SL25 | 187-318 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.