DPCstruct | MC24050
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 331 ± 32 aa |
| Standard deviation of domain lengths | 32.21 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 88.82 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 35.59 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A497I810 | 363-690 | KEFRVQSSPSKSILEELCVPHTIDSAFVVLDQNHAAALLRCMGLLKGRGLSIDKFKEAYDEKLPALELINKLAGVEVKPYAPTYIGA… |
| A0A7C3EGI4 | 2-354 | NKIILPYGKLDMERFSVGKRALEILGVPHEVFIENVIVDNPDSRALLSNLGFLNNIPSEINFDFDFKSENEVLKAVNKLSKFKISDK… |
| A0A7J4JDE2 | 365-688 | None |
| Q18ER3 | 574-921 | None |
| A0A7J2YGL1 | 1-307 | None |
| A0A7J3TG79 | 509-849 | None |
| A0A075FG38 | 405-772 | None |
| A0A534IEJ0 | 3-316 | None |
| A0A842TJ82 | 1-249 | None |
| A0A7C2VNE7 | 206-524 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.