DPCstruct | MC24046
Metacluster Properties and Pfam Annotations
| Number of structural domains | 118 |
|---|---|
| Mean domain length (aa) | 135 ± 24 aa |
| Standard deviation of domain lengths | 23.79 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 88.94 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.54 |
| Mean intra-cluster sequence similarity (%) | 14.42 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0394 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A421EJ38 | 3-118 | KAAIVILAGNESHADYGRLANALEAAKEFAENDDDELKLIFDGAGTQWVPELEDEESDYHELYRAVRDDAAVCDYCSSAFDVADAVS… |
| F4CXX6 | 117-271 | QIVGTRAQAGDAIVDYDQKLFDDIQAEAGEKAYIFMHTVPYEGSVGLVNMLTCTRINRKGFDTSLVLYGPGVLMASATRGFPTVGSE… |
| A0A7X7FD24 | 304-481 | None |
| A0A7Y7D6M2 | 1-98 | None |
| A0A135VYB4 | 2-118 | None |
| A0A1B4XJJ6 | 334-463 | None |
| S3X3Z6 | 3-124 | None |
| A0A538Q5F5 | 160-314 | None |
| A0A258W0H7 | 170-300 | None |
| A0A1V5NKR9 | 2-100 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.