DPCstruct | MC24045
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 209 ± 10 aa |
| Standard deviation of domain lengths | 10.26 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 86.03 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 32.26 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| F4CJ11 | 1-221 | MTLPISELAGAVTILSQRRGADLRAAQWKPGPNRNARDAASFSTTIETSDHRSALSGEVMAALPNATSSAVVTCAELRIYDLAAWAD… |
| A0A5P8K3I0 | 367-576 | LPISRFAGAVTMLSLRRGADLPASDWQLGPHRNASDSLSYSATITAEGGRPVLAGAVMVALPGALQSHTVTCAEITIQDAAAWAAVL… |
| A0A7H8HKI3 | 596-813 | None |
| A0A1C4X335 | 362-581 | None |
| A0A495W397 | 750-943 | None |
| A0A1S2KQN1 | 489-697 | None |
| A0A2A4KF51 | 404-616 | None |
| A0A229RAV6 | 171-388 | None |
| A0A543JRL9 | 520-712 | None |
| A0A2I0STD7 | 636-827 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.