DPCstruct | MC24044
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 307 ± 37 aa |
| Standard deviation of domain lengths | 37.43 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 71.39 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 33.82 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5D2Q3I3 | 40-377 | CSCSRCTVSPSTLVDHALEEILASNPSFSSAGLDLNLYRDEANKKLSHYVDETITEFLSVGDPESCCKKLERVLKGGFHVEQLESKD… |
| A0A2I0VZY2 | 2-275 | DVSDYLEETIAEYMFDGTPEICCRKLEDMLCHSFHCMPSDALESRFRLHPLHFLSLKTCIVLSSAYRIQASNVDDVSKKFKMARAAA… |
| A0A1D6EB12 | 129-450 | None |
| A0A816NFX4 | 472-750 | None |
| A0A1U8AG90 | 64-428 | None |
| A0A2G5DKW4 | 13-332 | None |
| A0A067KEU3 | 1-233 | None |
| A0A0D9W4Y1 | 699-1020 | None |
| A0A2I4GJY1 | 319-664 | None |
| A0A7I8L481 | 249-484 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.