DPCstruct | MC24042
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 121 ± 13 aa |
| Standard deviation of domain lengths | 13.41 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 86.08 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 41.37 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1D6NQU1 | 1-136 | MAAAVEASAVTVDLASYLHRLQPRLLKLLRSNAFKAKPAHITLIGACATMGADVEVTASISCLRDAIASDDWATRKAAAEALAALAL… |
| V4TEN2 | 173-296 | VEQLRKLLPRLGKAVRIEGFKAKAAVLGVIGSVVRVGGARSKGVLDWLVPCLVEFLCCDDWATRKAAAEVLGKVAVFDKDLATEYKR… |
| A0A2U1NNR6 | 439-562 | None |
| A0A1D6EX59 | 158-255 | None |
| A0A811N3S7 | 751-844 | None |
| A0A2I0JHX6 | 28-155 | None |
| A0A2U1M4B8 | 97-229 | None |
| A0A2P5XZQ5 | 28-155 | None |
| A0A2U1LD81 | 4-121 | None |
| A0A835UTA1 | 251-350 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.