DPCstruct | MC24041
Metacluster Properties and Pfam Annotations
| Number of structural domains | 60 |
|---|---|
| Mean domain length (aa) | 147 ± 21 aa |
| Standard deviation of domain lengths | 21.37 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 79.02 |
| Mean fraction of residues predicted as intrinsically disordered | 0.37 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 44.97 |
| Pfam Score | 98.89 |
| Assigned Pfam label(s) | CL0123- PF04852 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6J8BSS4 | 123-256 | YDKKKVSLKKDLESFLIGRAKNLTSATPEDIRLFLIDRDMKGKTKIHDLCCPFLGDKKFKDCSCPCRLASGTVSSLASQLKAIFDSF… |
| A0A2I0VGS0 | 111-267 | SSTTTTTTTTLPLSPHHPPLSRYESQKLRDWNTFGQYLRNHRPPLTLSRCSGAHVLEFLRYLDQFGKTKVHSIACPFFGQPNPPSPC… |
| V4CMA1 | 4-123 | None |
| A0A0B0PY40 | 13-154 | None |
| Q652I1 | 2-170 | None |
| K4ALT7 | 240-405 | None |
| A0A5D2TBX5 | 215-382 | None |
| A0A445BYC7 | 1-153 | None |
| A0A199VW73 | 110-254 | None |
| A0A4S4D5P6 | 288-430 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.