DPCstruct | MC24039
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 66 ± 1 aa |
| Standard deviation of domain lengths | 1.43 |
| Length coefficient of variation | 0.02 |
| Mean AlphaFold2 pLDDT confidence score | 90.35 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.92 |
| Mean intra-cluster local Distance Difference Test score | 0.93 |
| Mean intra-cluster sequence similarity (%) | 68.24 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2P6PB45 | 146-209 | PNGEWMLIDKCLGLGLLNRFDVSQVFKCLIHWGTGTVNLELWSEERPVSNQSPLRISHEYEVID |
| A0A2I0VEI3 | 1-63 | MLVDRCAGLALVNRFDVRQVNKCLIHWGSGTVNLELWSEERPVSKETPLAIRHEYEVKQVSKL |
| A0A1Q3DJ98 | 59-122 | None |
| A0A6P6GKU5 | 93-158 | None |
| A0A061EQ28 | 58-123 | None |
| Q84PR1 | 1-68 | None |
| A0A0V0IXK5 | 581-646 | None |
| A0A2R6WTL3 | 130-194 | None |
| A0A072UDG9 | 694-759 | None |
| A0A0A9FSE5 | 29-95 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.