DPCstruct | MC24037
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 195 ± 11 aa |
| Standard deviation of domain lengths | 10.71 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 77.25 |
| Mean fraction of residues predicted as intrinsically disordered | 0.45 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 38.23 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0059 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6V8R4Q7 | 221-426 | GRGGILEEQCDASGTCSQDSQTFKGIYFHHLNAFCRPLQWDDINDRNTLNMDSFSHVKAAHRSACGAYLGWIKHNALAALRTRDSRG… |
| A0A4V1TZL5 | 1-186 | MERCDPSASCNQDGQTFKGIFFHHLTAFCDPLPRSAVRAGATYAADSQLAHSHRKQCEGYTDWVVHNARAAMRTRDEKGRFGSWWGA… |
| A0A1J7J487 | 397-596 | None |
| A0A6A6FV41 | 310-500 | None |
| A0A2C5ZZ26 | 9-223 | None |
| A0A2I0RTM9 | 261-455 | None |
| A0A7C8QH61 | 795-993 | None |
| A0A094AKM6 | 106-293 | None |
| A0A367L0J9 | 392-568 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.