DPCstruct | MC24036
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 168 ± 14 aa |
| Standard deviation of domain lengths | 13.64 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 91.53 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 27.25 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF20392 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S0QZF8 | 214-377 | AEYTQVVEEYHIMQKEECVQALCPEIGLAILTPPHPLHYYALFSRTIGYDTVLTIYPGNRYELECKYSGYIDITSRPVWPRLDLSPL… |
| A0A4Q5QQK8 | 5-154 | LTQRADYPGVGLVVMRTPAPGPYYALFGPTAGFDWVLSSYDGQRYELECKYTTWIDLESRPTLPRLPLAPLAARLNELERSNYRWAA… |
| A0A7S4CAC9 | 199-389 | None |
| A0A7W1HJP6 | 50-206 | None |
| A0A7S0SZ97 | 1-139 | None |
| W1IXM5 | 289-451 | None |
| C1E4W5 | 281-463 | None |
| K8E8W5 | 345-533 | None |
| A0A7S4NKI1 | 140-325 | None |
| A0A1Q4Z1R7 | 131-289 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.