DPCstruct | MC24033
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 112 ± 12 aa |
| Standard deviation of domain lengths | 11.69 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 85.47 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 30.09 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1G0AC99 | 49-147 | CDDLISYVKENYKTKQVVESYQLITSTWLKKVSAYSIENKIVVIAEIKLNEISLESKEYIFCEIPNENWNNFYYGTFDAMKTFGERF… |
| A0A4V1KSC6 | 1-121 | MKKALLLVLLITTFFSQAQDVACLDLLDYVKKNGYKKAEVSSYQLYDSSWLKKVTAYTIDNTILVVAEIKKDEYSIYTKEYIFCGIP… |
| A0A136MTM2 | 122-224 | None |
| A0A3D4ERB2 | 184-284 | None |
| A0A3G2GM30 | 59-177 | None |
| A0A5B7SWK9 | 3-101 | None |
| A0A4Q0PSQ9 | 11-140 | None |
| A0A176SVU5 | 1-122 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.