DPCstruct | MC2403
Metacluster Properties and Pfam Annotations
| Number of structural domains | 31 |
|---|---|
| Mean domain length (aa) | 167 ± 14 aa |
| Standard deviation of domain lengths | 14.06 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 88.57 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 17.00 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF13858 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A174NMN5 | 32-209 | MTENRSYLQKYAMHFGTYMGIYWILKFILFPLGFHIPFLSLLFVILTLAVPFIGYHYVKMYRDKICGGSIQFSHAVLFTIFMYMFAS… |
| A0A0R2SER9 | 2-141 | QFVWLIGEYLVGLHTTYINLHSLYTNLILVPSVAIMIWGLFARKAELGGDLTYVQALGQGLGVGATVGILSVGIQYLFFTYINPNFF… |
| A0A1H9JF95 | 2-172 | None |
| A0A5D8YRG0 | 7-185 | None |
| A0A2E4HGY4 | 71-249 | None |
| A0A2D5BCA9 | 11-192 | None |
| A0A5B8UEW7 | 1-170 | None |
| A0A1F1EBK7 | 15-178 | None |
| A0A7Z1TTY1 | 1-168 | None |
| A0A255ZRT4 | 23-193 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.