DPCstruct | MC24029
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 124 ± 20 aa |
| Standard deviation of domain lengths | 20.38 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 89.46 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 20.63 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0004 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Y9V651 | 94-212 | MPIYLAAESELTVGQALVLEAPAEEGSFIVVFEDDGDTGYFYALDTAAEDNPIHDALHIYNAADVTDGHKPSMVKIGWAVDHRKAVL… |
| A0A6P1U7W4 | 7-133 | AEQLITPGQARVIDARSPFAPLATRFEDDGHTAYFYALDFEDEGGFAVADSMLIYNVRALQMPHQPAKLQIIWSTDGRMSGLFIDDY… |
| A0A7J9Z3V3 | 14-150 | None |
| A0A837LZ78 | 32-173 | None |
| A0A0H3KU07 | 1-150 | None |
| A0A1G3LKF8 | 11-128 | None |
| A0A4Q2X5F7 | 50-182 | None |
| A0A4U5JVM4 | 1-89 | None |
| A0A7V7MN16 | 36-135 | None |
| A0A7W0HRU4 | 1-120 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.