DPCstruct | MC24028
Metacluster Properties and Pfam Annotations
| Number of structural domains | 98 |
|---|---|
| Mean domain length (aa) | 166 ± 36 aa |
| Standard deviation of domain lengths | 35.99 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 76.33 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 28.07 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0688 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| L9MBQ8 | 2-107 | NKAIMEKTTVHRAMYRNDLGWVDFEYGSDKQGIKHIIKRRMESDGMTYDEVVHMLVDTIVQTIAQGSTQRRTERGLSTRINIVFNSH… |
| A0A6P1U7G6 | 16-166 | NGAFGPIFTQFRHDAQGAIEHLRQQQTGEAVAALHHPEVGDIDLVWGREGTAAKNYEDGHGIAKIAKKHPEVLGDLQGFVEALSVNP… |
| A0A1X9SW42 | 115-299 | None |
| A0A0K2Y3P7 | 697-875 | None |
| A0A0K2XZH7 | 223-390 | None |
| A0A0K2XBB5 | 1-140 | None |
| K2KTY4 | 220-500 | None |
| K2KT25 | 241-410 | None |
| K2JYI6 | 47-360 | None |
| A0A0K2XY57 | 201-368 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.