DPCstruct | MC24025
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 72 ± 4 aa |
| Standard deviation of domain lengths | 3.99 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 67.48 |
| Mean fraction of residues predicted as intrinsically disordered | 0.99 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 62.09 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A316ULA1 | 1-66 | MPSSKGEPTDPQLRERIKEQIKKEAGGGWAAWCGAKLAKEYERQGGGYKNTPDNPNKPKKGTPEPK |
| A0A423WJ00 | 1-83 | MPSSKGIPTDPELRDELKEDIKQETNKDGGGKGQWAAWKASKLAKEYEKQGGGYENEPGSKNEPKEGKPEHKSESKKKNEKEG |
| A0A4U0VMC6 | 40-110 | None |
| A0A0D2GE93 | 1-71 | None |
| A0A6A5QPY3 | 1-72 | None |
| E4ZNS8 | 4-74 | None |
| A0A0N1HGS6 | 1-69 | None |
| A0A1B9HJ20 | 1-73 | None |
| A0A5M6BR69 | 1-72 | None |
| A0A140KNL0 | 1-70 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.