DPCstruct | MC24024
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 253 ± 10 aa |
| Standard deviation of domain lengths | 10.09 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 79.84 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.54 |
| Mean intra-cluster sequence similarity (%) | 19.75 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A6RWC9 | 165-424 | VCHTLSVLLPRLRSLRLRTSHFCSGLLSSISPQATFDPERPHCKATWKANATSPLQYLLIRLITSPEDEQRAHTTLCYTGDKMLYGA… |
| A0A423W3L7 | 2-257 | CDSFRTVVGRIQYLRLRLTKVCSAVFGEHDKMGSRPVGAPKLKDCIINLTQRTPGTSPGFVDDFMRLPIPLPSLIPKLQSSAQVTST… |
| A0A6A5KC44 | 86-328 | None |
| A0A2L2T117 | 70-316 | None |
| A0A6A6NYK7 | 165-423 | None |
| A0A084B6J3 | 435-687 | None |
| A0A084S0M2 | 527-799 | None |
| A0A178DUP1 | 1-245 | None |
| A0A0D2KDM9 | 192-427 | None |
| A0A084G6Z8 | 61-319 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.