DPCstruct | MC24020
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 241 ± 70 aa |
| Standard deviation of domain lengths | 69.59 |
| Length coefficient of variation | 0.29 |
| Mean AlphaFold2 pLDDT confidence score | 89.65 |
| Mean fraction of residues predicted as intrinsically disordered | 0.47 |
| Mean length-normalized TM-Score | 0.48 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 24.21 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1R1GGT9 | 1-166 | MKGFKVFNKDWACRGFQYVVGQTFTHEGRFGLCNAGLHFCAKLEDCFEYYPFNPENKVAEVEALGEIENGDDKSVTNKLAIIRELTW… |
| A0A7Z6VGG9 | 6-300 | KAASEEVVTAYKGFKQDLTCRDYQFEIGGTYKHDGEVEACASGFHSCEYPLDVFGYYAPGDSRFAIVKASGQLSRHDDDSKIASATL… |
| A0A4V3RTI5 | 2-199 | None |
| A0A7X7LHR2 | 19-188 | None |
| A0A2N5PMJ6 | 1-199 | None |
| A0A2E3PG02 | 1-223 | None |
| A0A5M6BIM9 | 1-340 | None |
| A0A6S6YIP7 | 3-295 | None |
| A0A5C7P2B1 | 48-235 | None |
| A0A743YMQ5 | 2-381 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.