DPCstruct | MC24013
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 80 ± 10 aa |
| Standard deviation of domain lengths | 10.47 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 88.71 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 30.25 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Q3UQ19 | 2-69 | KGTVQGFSFIALVFSEQSEYGINQGRVSKLFMEKANQRVLVYDRKWDIEPTEQESITAFNKLLSGLEA |
| A0A1Y4W2K3 | 11-82 | EDGIWLLGVVDDHPFEAKVCDEASGFGIDCGRVIKLHIRGKQASSEIVAYERGWDRFPKGAHKGLARAVIRF |
| A0A7U3ZP62 | 38-109 | None |
| A0A7R8BXI6 | 13-86 | None |
| A0A4R3QIZ9 | 22-105 | None |
| A0A4P7JI53 | 193-263 | None |
| A0A3C1R0I5 | 36-121 | None |
| A0A3A0BTF7 | 85-179 | None |
| A0A640VY99 | 19-113 | None |
| A0A1X2FXE2 | 2-102 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.