DPCstruct | MC24004
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 210 ± 70 aa |
| Standard deviation of domain lengths | 70.13 |
| Length coefficient of variation | 0.33 |
| Mean AlphaFold2 pLDDT confidence score | 91.15 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 43.66 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0179 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2P8DAU4 | 50-401 | EGIRYYVKRGVTELLVQKKYMGSYCDIYLHRDLDATYFVSRNGHLIQHIDLEAARQACQAMHARLDWDGVQLVIIQAEMMPWSILGK… |
| A0A7W1PH27 | 124-347 | LPEAVAVAGRAAKRGLDVGALVERFTTRASLVERYTAAWQRYCWPVTSVADLKLAPFHVLATQGAVHADKDHRWHMETAASICGADD… |
| W7YXD7 | 22-145 | None |
| A0A2S2BVN2 | 249-553 | None |
| A0A7C3J7Q2 | 1-122 | None |
| A0A7W0RNH7 | 899-1126 | None |
| A7C1P4 | 278-500 | None |
| A0A516PWY4 | 54-200 | None |
| A0A384IRY3 | 1045-1269 | None |
| A0A1G8CZU5 | 68-223 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.