DPCstruct | MC24002
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 320 ± 37 aa |
| Standard deviation of domain lengths | 37.19 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 84.59 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.54 |
| Mean intra-cluster sequence similarity (%) | 19.76 |
| Pfam Score | 91.67 |
| Assigned Pfam label(s) | CL0559- CL0159 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7V0RIH7 | 33-360 | EGKNGFINLKFQVAYDDNDAYFRFQWKTLNNYPGWAHPYYRYDGKAWKVYGYPKLDAVVQDGEQPGIYEDRMSMMIDDGKVENYAKQ… |
| A0A7W1PEK4 | 123-474 | NTLFATRTDFAPTIDGLGEALWTQAQPIVIPIGGGWAAADAVAMRALYDDHYLYIYLRWTDNQASFKRQPWIRRDDGTWLAQAAKPT… |
| A0A2R6BPP6 | 21-369 | None |
| A0A651H3H7 | 238-608 | None |
| A0A521H7C8 | 23-401 | None |
| A0A0F2IXY3 | 48-351 | None |
| A0A7C1N5H0 | 304-622 | None |
| A0A7X9ID60 | 13-293 | None |
| A0A1G1MMC1 | 198-471 | None |
| A0A3S0IM77 | 53-430 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.