DPCstruct | MC240
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 64 ± 6 aa |
| Standard deviation of domain lengths | 6.25 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 82.38 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 52.89 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7W1AEY6 | 1-52 | MRAEYDFSHGVRGKYASRLKPGGMLVVLDPDIAEAFGDAKTVNRTLRALLKA |
| A0A2V9IEY5 | 1-61 | MRPEYDFSAAVRGLTAARYARGANIAVIDPKVLDVFPDSTTVNQTLRALAPVLRRQRRRAS |
| A0A552DKQ5 | 3-67 | None |
| E1YAI6 | 10-70 | None |
| A0A6A7KY77 | 6-74 | None |
| A0A6J4LXM0 | 60-119 | None |
| A0A7Y4VNR6 | 6-80 | None |
| A0A7V7D4Y6 | 1-59 | None |
| A0A1W9MU00 | 1-73 | None |
| A0A2E0ZFX0 | 2-71 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.