DPCstruct | MC24
Metacluster Properties and Pfam Annotations
| Number of structural domains | 45 |
|---|---|
| Mean domain length (aa) | 189 ± 41 aa |
| Standard deviation of domain lengths | 40.75 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 86.25 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 23.60 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF16593- CL0693 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| L1NEL7 | 1-176 | MGKKVLGLDLGVGSIGWCLITLDKDEKPQSILGMGSRIVPLSADDATEFTQGKAITKNKMRTVARTIRKGMDRYQLRREALKKVLRE… |
| A0A377L925 | 4-216 | DYTIGLDIGTNSVGWAVITDEYRLMAKKMSIHGNTEKKKVKKNFWGARLFDEGQTAEARRSKRTTRRRLMRRRYRILELQKIFAEEI… |
| A0A1E5INB4 | 1-206 | None |
| B1GZ56 | 19-164 | None |
| A0A316QB55 | 3-225 | None |
| A0A3F3H306 | 1-209 | None |
| A0A380JD47 | 17-245 | None |
| A0A3N0I2S3 | 4-132 | None |
| A0A1H9D582 | 1-169 | None |
| A0A0Q4IQB3 | 1-169 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.