DPCstruct | MC23998
Metacluster Properties and Pfam Annotations
| Number of structural domains | 756 |
|---|---|
| Mean domain length (aa) | 137 ± 24 aa |
| Standard deviation of domain lengths | 23.81 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 79.68 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.47 |
| Mean intra-cluster local Distance Difference Test score | 0.47 |
| Mean intra-cluster sequence similarity (%) | 13.05 |
| Pfam Score | 96.07 |
| Assigned Pfam label(s) | PF13511- CL0750- CL0159- CL0353 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2V4AFR5 | 2-74 | VIKADKIVYGTISELDSTTLTLKIEGSLTNDSGTLKIERFEDWTCASRWTEYKIGQRVFLFLTSWKGKLIAMS |
| A0A644YWU4 | 47-180 | FSNKISLRTYKISHSWAIDIKDPKQVYDNSDFIFIGTVEKQVGTITYGNFPETQFSVIVHQLIKGNIKDTIVVNQEGGIKNYTLTIA… |
| A0A7C1EBX7 | 10-141 | None |
| A0A6A5DGM3 | 270-409 | None |
| A0A368FA52 | 37-154 | None |
| A0A7W1YMD1 | 2-140 | None |
| L9KKJ8 | 86-204 | None |
| A0A7T2GLK4 | 144-259 | None |
| A0A358EQ10 | 13-148 | None |
| A0A5J5CHL1 | 272-445 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.