DPCstruct | MC23997
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 243 ± 26 aa |
| Standard deviation of domain lengths | 26.49 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 81.10 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.37 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 19.49 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0236 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A644YUN0 | 21-235 | LYALGALEIFDGIYDIDSLSMIIYQPRRSNVSTFTMAKVDLYQWVEETLKPAAELSYAGEGDFKCGDWCQFCKVKQDCRKRAEYNME… |
| A0A7K4FKP5 | 1-256 | EASWDGIPIHGYIDRIDRAPGGGLAVLDYKTSRELRSEDARESDQLSLYQVLVEKNYSDPVEELTLYHLRSLTPLRVSQRPKETLEL… |
| A0A5C7PZX0 | 8-293 | None |
| A0A134AB22 | 2-215 | None |
| A0A417KJR1 | 154-367 | None |
| A0A351RD08 | 143-390 | None |
| A0A522FHP5 | 174-411 | None |
| A0A2G8DL14 | 250-478 | None |
| A0A3M2CEL1 | 151-401 | None |
| I6B1I2 | 1007-1261 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.