DPCstruct | MC23995
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 124 ± 10 aa |
| Standard deviation of domain lengths | 9.87 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 90.36 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 26.42 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7L4PL83 | 75-207 | IIRILKKEGHLKGELSETDIERIKTRVNLATNWVKLYAPDMIKFEILTEAPKVDLSKEQREGLKIISDLIQGEDLTDVELHNKIYEI… |
| A0A644YLE8 | 1-122 | MTDSQKQRLRTRCTCAWNWITTFAPEDFKYRLSNENDPKVELTEQELKAVKALYQVVEVMDQLEDKEYTTRLYDAAKLNDLDTGEFF… |
| A0A5E4I4S9 | 649-776 | None |
| A0A822IVL3 | 180-301 | None |
| A0A256Y079 | 597-725 | None |
| A0A1F3VMG3 | 259-382 | None |
| A0A0L0LJ09 | 1-143 | None |
| A0A1F7I819 | 432-556 | None |
| A0A832ZF59 | 139-257 | None |
| A0A843LJK4 | 141-259 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.