DPCstruct | MC23993
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 72 ± 4 aa |
| Standard deviation of domain lengths | 3.76 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 89.00 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 37.06 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1F8U4L4 | 2-69 | KQHGATDICYCISFNQDIDARYLTLTFALENAVGYGLPSIISCVPERLAYFESEQCYGAPYRFLLSKL |
| A0A5F2A4A6 | 1-70 | MILSIVRNVPEEAYIISESTKLDDRFLNLDEALSEVIGFGASTIVSVIPGELAYYEGEDLGERFLLLKID |
| B7HGK0 | 1-79 | None |
| A0A2V9YBZ5 | 39-109 | None |
| A0A7V9RAC7 | 26-98 | None |
| A0A0V8GHK9 | 29-104 | None |
| A0A7Y6UDU9 | 49-121 | None |
| A0A6J4SS80 | 182-255 | None |
| A0A254NST5 | 2-67 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.