DPCstruct | MC2399
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 120 ± 15 aa |
| Standard deviation of domain lengths | 15.04 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 77.98 |
| Mean fraction of residues predicted as intrinsically disordered | 0.39 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 33.22 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF04997 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A7TPB9 | 118-244 | HNEQMNQAIKIKDPKKRFNAVWTLCKTKMICETDVPSEDDPTKLVSRGGCGNAQPTIRKDGLKLVGSWKKDKNTNDGDEPEQRVLST… |
| A0A813CEI4 | 1-139 | MKQISRKKRLQAVMLCCRARRTCSVKQEEEAPTDEVPDGDASKFRGGCGYLQPRYYVEATVMMVAFPDIDGQEDKAQDRKRAMSADE… |
| A0A820AGP6 | 8-126 | None |
| A0A4Y9Y8T5 | 250-377 | None |
| A0A7S0MHA2 | 5-99 | None |
| R9PL38 | 7-108 | None |
| A0A5D3DCE1 | 448-553 | None |
| A0A0G4NF65 | 64-196 | None |
| A0A125SUX3 | 1-131 | None |
| A0A4W3H232 | 6-98 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.