DPCstruct | MC23986
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 98 ± 11 aa |
| Standard deviation of domain lengths | 11.21 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 82.69 |
| Mean fraction of residues predicted as intrinsically disordered | 0.38 |
| Mean length-normalized TM-Score | 0.51 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 31.01 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A072NSM2 | 1-98 | MAPRDCIVGKRLSVKSSIQEEILSMKQCLKICNDAKRQMALDRVNVFQDFTMADNSDQIIVSTLSDLMVAKHVTLGARSKQWLRQMS… |
| A0A319A1C2 | 1-90 | MYKDPTNLNLIKEERESIIQCLNVCSEASELAHRARTNIFEDVTSSDESHQLVVSTIGDLISAKHIITGSKSAQWLGQMSDTSLQQL… |
| A0A1E1K8C9 | 2-105 | None |
| A0A179UBE8 | 3-94 | None |
| X0H6R5 | 6-103 | None |
| J3PF73 | 92-212 | None |
| A0A177ABE9 | 40-141 | None |
| A0A094E494 | 1-80 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.