DPCstruct | MC23985
Metacluster Properties and Pfam Annotations
| Number of structural domains | 38 |
|---|---|
| Mean domain length (aa) | 339 ± 67 aa |
| Standard deviation of domain lengths | 66.60 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 68.83 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.39 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 17.84 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF20253 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| T0SI94 | 1-275 | MGRHSECGRWYRYKTATNAVVAWLKRSSVGKAKKAKASAGEWTTPMIWAAAVKIADKAMPVPASIMRQLTRSIRLRWLSSQAVSEPD… |
| C7ZHN3 | 1-324 | MPPDPLVSIYQQYKQGTDFVASWLASTAKSCGYSTGDTAPSVSNTGQEKKNAKRKGKQSAKETTFKTVVAIKDFVPMAKIISSHKPS… |
| A0A162MTM9 | 1-305 | None |
| A0A2H3SA45 | 1-196 | None |
| A0A0A2K9R1 | 2-345 | None |
| A0A7D8UY29 | 7-380 | None |
| A0A177VUS6 | 105-478 | None |
| A0A177VVX0 | 46-462 | None |
| A0A177UZC0 | 84-620 | None |
| A0A163KEU4 | 42-390 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.