DPCstruct | MC23979
Metacluster Properties and Pfam Annotations
| Number of structural domains | 53 |
|---|---|
| Mean domain length (aa) | 117 ± 13 aa |
| Standard deviation of domain lengths | 13.33 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 88.93 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 35.10 |
| Pfam Score | 95.26 |
| Assigned Pfam label(s) | CL0179- CL0021 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6L7E444 | 89-198 | ETQSAGLDLLDELGFKTNKERRMCQTIEEVIDLIETLKVKRADFSYEIDGIVIKVDSLAQQEELGFTAKSPRWAVAYKFPAEEVVTK… |
| A0A376NWZ2 | 17-140 | VWAWPDGPQLMTDRLKELATAGFTLTQRYTRAVKNADEVARVRNEWWKAKLPFVTDGVVVRGAKEPESCHWLPGQAEWLVAWKYQPV… |
| A0A1A9UKD4 | 2-107 | None |
| A0A837Q3Q1 | 7-136 | None |
| A0A378NAE0 | 1-114 | None |
| A0A7S1YQA6 | 12-165 | None |
| A0A7V4UW92 | 2-118 | None |
| A0A368TSW0 | 102-219 | None |
| A0A485AZ12 | 61-188 | None |
| A0A485AQA7 | 12-149 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.