DPCstruct | MC23978
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 69 ± 4 aa |
| Standard deviation of domain lengths | 4.09 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 83.86 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.93 |
| Mean intra-cluster local Distance Difference Test score | 0.93 |
| Mean intra-cluster sequence similarity (%) | 57.52 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A848QCE1 | 121-186 | WVLTGSGLAVMLVAGIAFGNLFLGLPFRFDDDLRMSWHGGFIDLLHPFALLCGLVSLGMLLAHGAC |
| A0A376MUY0 | 5-70 | LVIGSLVPPVVFGIAFGNLLLGVPFAFTPQLRVEYLGSFWQLLTPFPLLCGLLSLGMVILQGGVWL |
| A0A379WDK9 | 56-127 | None |
| A0A1L8ZQL0 | 67-133 | None |
| A0A378N7A5 | 1-68 | None |
| A0A377F7F0 | 29-100 | None |
| A0A3M7LI55 | 64-138 | None |
| A0A3S4JH80 | 1-72 | None |
| A0A376KWS0 | 77-146 | None |
| A0A377XT63 | 1-60 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.