DPCstruct | MC23977
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 96 ± 9 aa |
| Standard deviation of domain lengths | 9.22 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 84.40 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 39.63 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A8B5WRA1 | 9-107 | AVVFSNRLKKRYKHLSRWARRVGTTCFRIYDRDVPELPFTVEVYGSNLVVAAHMRPEEAASQTRRDWVDTMVSAAARALSVQPDNVY… |
| A0A376MUQ5 | 6-84 | YANRLRKNLKKFEKWARQEGIECYRLYDADLPEYNVAVDRYADWVVVQEYAPPKTIDAHKARQRLFDIIAATISVLGLR |
| A0A7Y0RQJ3 | 155-259 | None |
| A0A2X1RGD9 | 54-148 | None |
| A0A378PJK1 | 462-560 | None |
| A0A3M8FVD2 | 397-487 | None |
| A0A376VMU2 | 52-149 | None |
| A0A1W9F3V4 | 11-110 | None |
| A0A2X2DIH9 | 2-86 | None |
| E8LLU6 | 404-501 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.