DPCstruct | MC23976
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 80 ± 7 aa |
| Standard deviation of domain lengths | 7.18 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 89.80 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 46.09 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2D2D5N1 | 13-88 | MLAFAVGADLEQLAALYGVARRLIAAATANAAAVYESDAELRRRAQIAPEAFTTCGSAGAYVHHALEAAPELIDAR |
| A0A376MUK0 | 4-82 | HSRGSDLDNLAANNNTRRLVIHPATDTTEAVMESDTSLRLRAQSAWDGLSVAGPSGAYEYFARSASGLVRDARAHQPVT |
| A0A6N8PP11 | 1-83 | None |
| A0A654C1I4 | 75-156 | None |
| A0A0T9LR98 | 84-152 | None |
| A0A7U7FD77 | 83-166 | None |
| A0A7X6JCD4 | 58-138 | None |
| A0A3N6RV94 | 83-166 | None |
| A0A2A8MGB2 | 1-68 | None |
| A0A812QW15 | 86-168 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.