DPCstruct | MC23975
Metacluster Properties and Pfam Annotations
| Number of structural domains | 37 |
|---|---|
| Mean domain length (aa) | 77 ± 8 aa |
| Standard deviation of domain lengths | 8.24 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 90.14 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 49.32 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A848SLA6 | 16-99 | ARSLILATGARWRELGVPGEADYRNKGVAYCPHCDGPLFKGKRVAVVGGGNSGVEATIDLAGIVEHVTLIEFDANLRADEVLQA |
| A0A376MUC8 | 7-78 | HAISGLPSEEAFKGRGVSACATCDGFFYRNQKVAVIGGGNTAVEEALYLSNIASEVHLIHRRDGFRAEKSLL |
| X1HMI4 | 1-55 | None |
| A0A5N9CS94 | 197-277 | None |
| N1QQ95 | 83-158 | None |
| A0A7S2RHI1 | 92-176 | None |
| A0A523RKD0 | 160-239 | None |
| A0A523TWX7 | 151-231 | None |
| A0A7J0E421 | 140-214 | None |
| A0A0G0V3U4 | 108-188 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.