DPCstruct | MC23974
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 156 ± 16 aa |
| Standard deviation of domain lengths | 15.82 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 91.07 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 36.27 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0063- CL0506 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| I6ESZ0 | 2-141 | RLKIVNAMKATGKPMVALFLGYTPAVARDENVWFASSLDEAARLACLLSRVTARRNAIAPVSSGFICGLYTGGTLAAEAAGLLAGHL… |
| A0A376MRR5 | 1-187 | MLISKPPAPAVARKVLERARACRKPVVVCFLGRGETPVDEQGLKFARGSKEAALKAVMLSGVKQEHLDLHTLNQPLIADVRARLKPQ… |
| A0A6G9I9N3 | 534-705 | None |
| A0A7X7FE86 | 1-146 | None |
| A0A8B5W7B0 | 3-146 | None |
| A0A376LJF4 | 1-156 | None |
| A0A1H9SHS8 | 254-403 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.