DPCstruct | MC2397
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 127 ± 14 aa |
| Standard deviation of domain lengths | 14.05 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 88.92 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 43.47 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A812PXX2 | 562-689 | MGQLLLTKRDQGELDWEQELAEALNRAEDRCLANCGRAPWGCRWFEEWRKNVDKAVELNQTLHVFYFESLAGHGKMAWHQLPDAKVR… |
| A0A813CAM7 | 1-149 | AMGQLLLIKYPHTTHIEWREKQAEATEKALQLWQQSQGRAPWGCRWFELWKERVDEAVKLNQTLHVFYFKGRVGAGKLSWDQLGHDE… |
| A0A812QCC4 | 17-151 | None |
| A0A813A176 | 124-231 | None |
| A0A1Q9BYR2 | 684-811 | None |
| A0A1Q9CBD6 | 544-686 | None |
| A0A812L1N4 | 736-860 | None |
| A0A812X2I3 | 187-314 | None |
| A0A812VZJ9 | 156-283 | None |
| A0A812Q8K7 | 296-440 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.