DPCstruct | MC23964
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 160 ± 22 aa |
| Standard deviation of domain lengths | 21.83 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 81.06 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 19.61 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| C5ZV82 | 3-126 | VNLTNEMLKILQTSGIAANLADLTLDKNGIYFSLPNQTTTKVMLYQAKIQESLFRTQGEPLVHLSACDESLKNYDNADFLAIIRTDM… |
| A0A290TYZ0 | 1-184 | MKIEIDFSTLQTATLKMGAPNKHIKLDSPLGKINPIDNGLGIGLVLGEDLQLSEIDNTNNLLSYKGRQIMLYIPEQGSQIEEVIKDG… |
| C6I003 | 118-316 | None |
| A0A651FDH2 | 35-169 | None |
| A0A1Q3PBZ2 | 1-165 | None |
| A0A1I1FF74 | 1-161 | None |
| A0A1H4ANV7 | 12-168 | None |
| A0A1G4YFD5 | 1-176 | None |
| A0A376L2W2 | 1-158 | None |
| A0A3D8IG24 | 4-129 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.