DPCstruct | MC23961
Metacluster Properties and Pfam Annotations
| Number of structural domains | 60 |
|---|---|
| Mean domain length (aa) | 168 ± 32 aa |
| Standard deviation of domain lengths | 31.57 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 90.39 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 24.79 |
| Pfam Score | 88.24 |
| Assigned Pfam label(s) | PF01814- PF04405 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2X1PQM2 | 3-142 | DHIITRFHNRHREQLPELITLAEKVENVHGDRDDCPIGVTAQLEKIYAELSQHLMKEEQILFPMIKMGNYAMASMPIRVMEMEHDEA… |
| A0A4P6PJD6 | 193-383 | WPETEAALLAVLEQRPEMDSTDWSSAPLSELIDHIVNTHHVFTKEQLPRLDGLLEKVQIAHGEHHGEMLGKLRLAYTAIRTELESHL… |
| E0I5F8 | 55-239 | None |
| M0JI73 | 2-156 | None |
| A0A0F9SRK3 | 51-240 | None |
| A0A0D3LKG7 | 79-277 | None |
| A0A7X7FE00 | 18-186 | None |
| A0A5Q4DS87 | 22-152 | None |
| A0A4P1K4H2 | 17-139 | None |
| A0A1M4XKL7 | 7-154 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.