DPCstruct | MC23958
Metacluster Properties and Pfam Annotations
| Number of structural domains | 32 |
|---|---|
| Mean domain length (aa) | 71 ± 10 aa |
| Standard deviation of domain lengths | 9.60 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 87.58 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 42.47 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Q2WKD5 | 30-89 | GILGSIAGIIGCIQATEAVKYLLGQGDLLVNRMLTMDGLTMSFLEVEIRRDNQCPDCGNN |
| A0A1H7IT84 | 8-67 | MQALEAVKYITGQGELLTGSMLVFDGLKMEWRKVKLPKRNSLCPICGDSPAIKELFDEEQ |
| A0A7M5XG37 | 34-114 | None |
| S9QY88 | 42-97 | None |
| A0A1F8LK67 | 1-85 | None |
| A0A7W0A0G2 | 2-58 | None |
| A0A534ZP82 | 5-76 | None |
| A0A6A7G899 | 529-608 | None |
| A0A7C2XTY1 | 432-509 | None |
| A0A1X7SR26 | 11-84 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.