DPCstruct | MC23952
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 314 ± 45 aa |
| Standard deviation of domain lengths | 45.42 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 76.78 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 39.17 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF15113 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0G4IH95 | 58-385 | ALVYLAVGLFFGKYVLHDFLFRNRFEWAMFNDDKGSWFCMCLSSLWSLYAGCFIFNALEELCNPKANDYDGFNDGLGFTFGEFHEFL… |
| A0A7S0FBA6 | 99-454 | IVVFFIIGVYVSRMWLHHRLLRDCMGLLMFEGDKGTLLIELFGVSFAGYGAALAYNGLIPFIDKDATPIQSRTWAEIRHVGKAFQVW… |
| A0A443QPI3 | 277-672 | None |
| A0A673Y4I4 | 38-338 | None |
| A0A1A8I1S2 | 1-310 | None |
| V3ZRJ9 | 6-318 | None |
| A0A0K2VB14 | 32-302 | None |
| A0A7R9E521 | 12-262 | None |
| A0A1S3JC49 | 71-424 | None |
| A0A7R9ASI3 | 62-340 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.