DPCstruct | MC23950
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 98 ± 10 aa |
| Standard deviation of domain lengths | 10.01 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 71.53 |
| Mean fraction of residues predicted as intrinsically disordered | 0.77 |
| Mean length-normalized TM-Score | 0.48 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 57.79 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7W4VK11 | 50-157 | GAGGPALAKGGVLSRGMLMPFAKGGVVGAPTYFPLGRGLGLMGEQGAEAVMPLARGPDGRLGVRGGGGGRPVSVTVNVTTPDAESFR… |
| A0A2H6IYF0 | 1-90 | MPFARGGVIASPTTFPLAGGRTGLAGEAGPEAILPLARGSDGRLGVRSQASGGMTITFNVTTPDAQSFRQSESQVAAMLNRAVSRGG… |
| A0A0S3PZ59 | 105-211 | None |
| A0A7W2BMM8 | 1-104 | None |
| A0A7C5LXC0 | 1-74 | None |
| A0A1I3K1D3 | 311-410 | None |
| A0A1M4L9J1 | 211-311 | None |
| A0A0M9GPN9 | 85-186 | None |
| A0A545B9T4 | 110-203 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.